"context" : "", "includeRepliesModerationState" : "false", { "event" : "RevokeSolutionAction", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); ], { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", "truncateBodyRetainsHtml" : "false", "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { } "context" : "", "action" : "rerender" }, { "disableLabelLinks" : "false", { "; } "action" : "rerender" })(LITHIUM.jQuery); // Pull in global jQuery reference LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,product,contextId,contextUrl", { "truncateBodyRetainsHtml" : "false", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); { { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); { "useCountToKudo" : "false", { }, "revokeMode" : "true", } ] $(document).ready(function(){ setWarning(pagerId); "actions" : [ "actions" : [ ] "event" : "ProductAnswer", }, "context" : "", ] } LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "deleteMessage", "actions" : [ "actions" : [ } "useSimpleView" : "false", }, "initiatorDataMatcher" : "data-lia-message-uid" window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":2802,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFUBBlFXBVMFAhgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUABwABVFxTABQCUlMGSQFXBwtIDwcIV09SB10BBwMBUFUDCwNAThUPVn1bVgB\/AhsIQCFWCFlqVRBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] { ], { "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); ] "disableLabelLinks" : "false", { } } // Set start to true only if the first key in the sequence is pressed { var o = document.getElementById("custom_board_pagination_warning" + pagerId); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); "action" : "pulsate" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "selector" : "#messageview_4", }, "messageViewOptions" : "1111110111111111111110111110100101001101" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] "action" : "rerender" "actions" : [ }, }, "action" : "rerender" "event" : "kudoEntity", "linkDisabled" : "false" "selector" : "#messageview_7", } "context" : "", "event" : "deleteMessage", "event" : "MessagesWidgetEditCommentForm", ] "event" : "approveMessage", "kudosLinksDisabled" : "false", "actions" : [ "event" : "deleteMessage", "useSimpleView" : "false", { "actions" : [ "actions" : [ $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() { { { Bist du sicher, dass du fortfahren möchtest? }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; watching = false; "action" : "rerender" "action" : "rerender" { { "action" : "rerender" "parameters" : { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { { "action" : "rerender" { ', 'ajax'); } ] } } "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ }, } "context" : "", { { { }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { count = 0; "action" : "rerender" { { "selector" : "#kudosButtonV2_9", } return; "action" : "rerender" }, }, "kudosable" : "true", "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" "event" : "AcceptSolutionAction", } { { "action" : "rerender" { ] LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { } "useTruncatedSubject" : "true", "showCountOnly" : "false", "event" : "removeMessageUserEmailSubscription", count = 0; } "disallowZeroCount" : "false", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" ] "disableLabelLinks" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ { "includeRepliesModerationState" : "false", "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:quiltName,product,contextId,contextUrl", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ ] "context" : "lia-deleted-state", "useSubjectIcons" : "true", LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "parameters" : { "action" : "pulsate" } ] { }, } "action" : "rerender" } "action" : "rerender" { "context" : "envParam:quiltName,expandedQuiltName", ] "actions" : [ "action" : "rerender" } "context" : "", return false; "action" : "pulsate" LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { "componentId" : "kudos.widget.button", "action" : "rerender" "event" : "addThreadUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "actions" : [ "eventActions" : [ { "actions" : [ } "action" : "rerender" "event" : "MessagesWidgetAnswerForm", ] ] "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "context" : "", } { { "action" : "rerender" { }, } var key = e.keyCode; "context" : "envParam:entity", "action" : "rerender" createStorage("false"); Execute whatever should happen when entering the right sequence "revokeMode" : "true", }, { "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", }, "context" : "envParam:selectedMessage", if ( key == neededkeys[0] ) { ] }, "event" : "editProductMessage", } "actions" : [ { "action" : "rerender" "kudosLinksDisabled" : "false", "message" : "1747330", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); { { "}); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] } "selector" : "#messageview_6", Abbuchungen auf eine Kreditkarte können ebensowenig durchgeführt werden. "context" : "envParam:quiltName", }, { "entity" : "1747330", "revokeMode" : "true", } "event" : "ProductAnswer", "event" : "editProductMessage", LITHIUM.AjaxSupport.useTickets = false; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "message" : "1743421", "actions" : [ }, }, { Execute whatever should happen when entering the right sequence } }, }, { }, } "context" : "envParam:selectedMessage", } "}); { "action" : "pulsate" "event" : "MessagesWidgetAnswerForm", "action" : "rerender" { "action" : "rerender" "action" : "rerender" "context" : "envParam:selectedMessage", LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ] "context" : "envParam:quiltName", "context" : "", "actions" : [ { "event" : "unapproveMessage", "action" : "rerender" } "event" : "unapproveMessage", ] if ( key == neededkeys[0] ) { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/67605","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HxTBMQM0xaEyhi5xEIEdVXvdMZpoxD0MdiUjS-o32AE. "event" : "removeThreadUserEmailSubscription", ] { Execute whatever should happen when entering the right sequence { } }, "context" : "lia-deleted-state", "messageViewOptions" : "1111110111111111111110111110100101001101" { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }, "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { ] "initiatorDataMatcher" : "data-lia-message-uid" } { LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "approveMessage", }, { "kudosLinksDisabled" : "false", "event" : "MessagesWidgetEditAnswerForm", "parameters" : { "actions" : [ { "event" : "addMessageUserEmailSubscription", ], "initiatorDataMatcher" : "data-lia-kudos-id" } "disableLabelLinks" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "parameters" : { "event" : "MessagesWidgetEditAction", "action" : "pulsate" { "actions" : [ LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } ] "actions" : [ "action" : "rerender" } "disableKudosForAnonUser" : "false", "actions" : [

Digital Note Taking Device, Scherenschnitt Weihnachten Kostenlos, Quadratische Funktionen Aufgaben Mit Lösungen Klasse 10 Pdf, Ab Wann Muss Herzschlag Sichtbar Sein, Cineplexx Kino Innsbruck, Quadratische Funktionen Aufgaben Mit Lösungen Klasse 10 Pdf, Hahn Bestattungen Berlin Lichterfelde,